Identification |
---|
Name | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase |
---|
Synonyms | - Phosphatidylglycerophosphate synthase
- PGP synthase
|
---|
Gene Name | PGS1 |
---|
Enzyme Class | |
---|
Biological Properties |
---|
General Function | Involved in phosphotransferase activity, for other substituted phosphate groups |
---|
Specific Function | Essential for the viability of mitochondrial petite mutant. Catalyzes the committed step to the synthesis of the acidic phospholipids |
---|
Cellular Location | Mitochondrion |
---|
SMPDB Pathways | Cardiolipin Biosynthesis | PW002431 | ![Thumb](http://smpdb.ca/super_pathway_visualizations/PW002431/thumb) ![Thumb?image type=greyscale](http://smpdb.ca/super_pathway_visualizations/PW002431/thumb?image_type=greyscale) ![Thumb?image type=simple](http://smpdb.ca/super_pathway_visualizations/PW002431/thumb?image_type=simple) | Cardiolipin Biosynthesis CL(10:0/10:0/10:0/28:0) | PW003484 | ![Thumb](http://smpdb.ca/super_pathway_visualizations/PW003484/thumb) ![Thumb?image type=greyscale](http://smpdb.ca/super_pathway_visualizations/PW003484/thumb?image_type=greyscale) ![Thumb?image type=simple](http://smpdb.ca/super_pathway_visualizations/PW003484/thumb?image_type=simple) | Cardiolipin Biosynthesis CL(10:0/10:0/10:0/30:0) | PW003501 | ![Thumb](http://smpdb.ca/super_pathway_visualizations/PW003501/thumb) ![Thumb?image type=greyscale](http://smpdb.ca/super_pathway_visualizations/PW003501/thumb?image_type=greyscale) ![Thumb?image type=simple](http://smpdb.ca/super_pathway_visualizations/PW003501/thumb?image_type=simple) | Cardiolipin Biosynthesis CL(10:0/10:0/12:0/26:0) | PW003502 | ![Thumb](http://smpdb.ca/super_pathway_visualizations/PW003502/thumb) ![Thumb?image type=greyscale](http://smpdb.ca/super_pathway_visualizations/PW003502/thumb?image_type=greyscale) ![Thumb?image type=simple](http://smpdb.ca/super_pathway_visualizations/PW003502/thumb?image_type=simple) | Cardiolipin Biosynthesis CL(10:0/10:0/12:0/28:0) | PW003503 | ![Thumb](http://smpdb.ca/super_pathway_visualizations/PW003503/thumb) ![Thumb?image type=greyscale](http://smpdb.ca/super_pathway_visualizations/PW003503/thumb?image_type=greyscale) ![Thumb?image type=simple](http://smpdb.ca/super_pathway_visualizations/PW003503/thumb?image_type=simple) |
|
---|
KEGG Pathways | Glycerophospholipid metabolism | ec00564 | ![Map00564](http://www.genome.jp/kegg/misc/thumbnail/map00564.gif) |
|
---|
SMPDB Reactions |
|
---|
KEGG Reactions | |
---|
Metabolites | YMDB ID | Name | View |
---|
YMDB00073 | Glycerol 3-phosphate | Show | YMDB00406 | Cytidine monophosphate | Show | YMDB00862 | hydron | Show | YMDB12067 | CDP-DG(10:0/10:0) | Show | YMDB12068 | CDP-DG(10:0/12:0) | Show | YMDB12069 | CDP-DG(10:0/14:0) | Show | YMDB12070 | CDP-DG(10:0/14:1(11Z)) | Show | YMDB12071 | CDP-DG(10:0/14:1(9Z)) | Show | YMDB12072 | CDP-DG(10:0/15:0) | Show | YMDB12073 | CDP-DG(10:0/15:1(11Z)) | Show | YMDB12074 | CDP-DG(10:0/15:1(9Z)) | Show | YMDB12075 | CDP-DG(10:0/16:0) | Show | YMDB12076 | CDP-DG(10:0/16:1(11Z)) | Show | YMDB12077 | CDP-DG(10:0/16:1(9Z)) | Show | YMDB12078 | CDP-DG(10:0/18:0) | Show | YMDB12079 | CDP-DG(10:0/18:1(11Z)) | Show | YMDB12080 | CDP-DG(10:0/18:1(9Z)) | Show | YMDB12081 | CDP-DG(10:0/20:0) | Show | YMDB12082 | CDP-DG(10:0/20:1(11Z)) | Show | YMDB12083 | CDP-DG(10:0/20:1(13Z)) | Show | YMDB12084 | CDP-DG(10:0/22:0) | Show | YMDB12086 | CDP-DG(10:0/22:1(9Z)) | Show | YMDB12087 | CDP-DG(10:0/23:1(11Z)) | Show | YMDB12088 | CDP-DG(10:0/23:1(9Z)) | Show | YMDB12089 | CDP-DG(10:0/24:0) | Show | YMDB12090 | CDP-DG(10:0/24:1(11Z)) | Show | YMDB12091 | CDP-DG(10:0/24:1(9Z)) | Show | YMDB12092 | CDP-DG(10:0/25:0) | Show | YMDB12093 | CDP-DG(10:0/25:1(11Z)) | Show | YMDB12094 | CDP-DG(10:0/25:1(9Z)) | Show | YMDB12095 | CDP-DG(10:0/26:0) | Show | YMDB12096 | CDP-DG(10:0/26:1(11Z)) | Show | YMDB12097 | CDP-DG(10:0/26:1(9Z)) | Show | YMDB12100 | CDP-DG(12:0/12:0) | Show | YMDB12101 | CDP-DG(12:0/14:0) | Show | YMDB12102 | CDP-DG(12:0/14:1(11Z)) | Show | YMDB12103 | CDP-DG(12:0/14:1(9Z)) | Show | YMDB12104 | CDP-DG(12:0/15:0) | Show | YMDB12105 | CDP-DG(12:0/15:1(11Z)) | Show | YMDB12106 | CDP-DG(12:0/15:1(9Z)) | Show | YMDB12107 | CDP-DG(12:0/16:0) | Show | YMDB12108 | CDP-DG(12:0/16:1(11Z)) | Show | YMDB12109 | CDP-DG(12:0/16:1(9Z)) | Show | YMDB12110 | CDP-DG(12:0/18:0) | Show | YMDB12111 | CDP-DG(12:0/18:1(11Z)) | Show | YMDB12112 | CDP-DG(12:0/18:1(9Z)) | Show | YMDB12113 | CDP-DG(12:0/20:0) | Show | YMDB12114 | CDP-DG(12:0/20:1(11Z)) | Show | YMDB12115 | CDP-DG(12:0/20:1(13Z)) | Show | YMDB12116 | CDP-DG(12:0/22:0) | Show | YMDB12118 | CDP-DG(12:0/22:1(9Z)) | Show | YMDB12119 | CDP-DG(12:0/23:1(11Z)) | Show | YMDB12120 | CDP-DG(12:0/23:1(9Z)) | Show | YMDB12121 | CDP-DG(12:0/24:0) | Show | YMDB12122 | CDP-DG(12:0/24:1(11Z)) | Show | YMDB12123 | CDP-DG(12:0/24:1(9Z)) | Show | YMDB12131 | CDP-DG(14:0/14:0) | Show | YMDB12132 | CDP-DG(14:0/14:1(11Z)) | Show | YMDB12133 | CDP-DG(14:0/14:1(9Z)) | Show | YMDB12134 | CDP-DG(14:0/15:0) | Show | YMDB12135 | CDP-DG(14:0/15:1(11Z)) | Show | YMDB12136 | CDP-DG(14:0/15:1(9Z)) | Show | YMDB12137 | CDP-DG(14:0/16:0) | Show | YMDB12138 | CDP-DG(14:0/16:1(11Z)) | Show | YMDB12139 | CDP-DG(14:0/16:1(9Z)) | Show | YMDB12140 | CDP-DG(14:0/18:0) | Show | YMDB12141 | CDP-DG(14:0/18:1(11Z)) | Show | YMDB12142 | CDP-DG(14:0/18:1(9Z)) | Show | YMDB12143 | CDP-DG(14:0/20:0) | Show | YMDB12144 | CDP-DG(14:0/20:1(11Z)) | Show | YMDB12145 | CDP-DG(14:0/20:1(13Z)) | Show | YMDB12146 | CDP-DG(14:0/22:0) | Show | YMDB12148 | CDP-DG(14:0/22:1(9Z)) | Show | YMDB12159 | CDP-DG(14:1(11Z)/14:1(11Z)) | Show | YMDB12160 | CDP-DG(14:1(11Z)/14:1(9Z)) | Show | YMDB12161 | CDP-DG(14:1(11Z)/15:0) | Show | YMDB12162 | CDP-DG(14:1(11Z)/15:1(11Z)) | Show | YMDB12163 | CDP-DG(14:1(11Z)/15:1(9Z)) | Show | YMDB12164 | CDP-DG(14:1(11Z)/16:0) | Show | YMDB12165 | CDP-DG(14:1(11Z)/16:1(11Z)) | Show | YMDB12166 | CDP-DG(14:1(11Z)/16:1(9Z)) | Show | YMDB12167 | CDP-DG(14:1(11Z)/18:0) | Show | YMDB12168 | CDP-DG(14:1(11Z)/18:1(11Z)) | Show | YMDB12169 | CDP-DG(14:1(11Z)/18:1(9Z)) | Show | YMDB12170 | CDP-DG(14:1(11Z)/20:0) | Show | YMDB12171 | CDP-DG(14:1(11Z)/20:1(11Z)) | Show | YMDB12172 | CDP-DG(14:1(11Z)/20:1(13Z)) | Show | YMDB12173 | CDP-DG(14:1(11Z)/22:0) | Show | YMDB12175 | CDP-DG(14:1(11Z)/22:1(9Z)) | Show | YMDB12186 | CDP-DG(14:1(9Z)/14:1(11Z)) | Show | YMDB12187 | CDP-DG(14:1(9Z)/14:1(9Z)) | Show | YMDB12188 | CDP-DG(14:1(9Z)/15:0) | Show | YMDB12189 | CDP-DG(14:1(9Z)/15:1(11Z)) | Show | YMDB12190 | CDP-DG(14:1(9Z)/15:1(9Z)) | Show | YMDB12191 | CDP-DG(14:1(9Z)/16:0) | Show | YMDB12192 | CDP-DG(14:1(9Z)/16:1(11Z)) | Show | YMDB12193 | CDP-DG(14:1(9Z)/16:1(9Z)) | Show | YMDB12194 | CDP-DG(14:1(9Z)/18:0) | Show | YMDB12195 | CDP-DG(14:1(9Z)/18:1(11Z)) | Show | YMDB12196 | CDP-DG(14:1(9Z)/18:1(9Z)) | Show | YMDB12197 | CDP-DG(14:1(9Z)/20:0) | Show | YMDB12198 | CDP-DG(14:1(9Z)/20:1(11Z)) | Show | YMDB12199 | CDP-DG(14:1(9Z)/20:1(13Z)) | Show | YMDB12200 | CDP-DG(14:1(9Z)/22:0) | Show | YMDB12202 | CDP-DG(14:1(9Z)/22:1(9Z)) | Show | YMDB12213 | CDP-DG(15:0/15:0) | Show | YMDB12214 | CDP-DG(15:0/15:1(11Z)) | Show | YMDB12215 | CDP-DG(15:0/15:1(9Z)) | Show | YMDB12216 | CDP-DG(15:0/16:0) | Show | YMDB12217 | CDP-DG(15:0/16:1(11Z)) | Show | YMDB12218 | CDP-DG(15:0/16:1(9Z)) | Show | YMDB12219 | CDP-DG(15:0/18:0) | Show | YMDB12220 | CDP-DG(15:0/18:1(11Z)) | Show | YMDB12221 | CDP-DG(15:0/18:1(9Z)) | Show | YMDB12222 | CDP-DG(15:0/20:0) | Show | YMDB12223 | CDP-DG(15:0/20:1(11Z)) | Show | YMDB12224 | CDP-DG(15:0/20:1(13Z)) | Show | YMDB12247 | CDP-DG(15:1(11Z)/15:1(11Z)) | Show | YMDB12248 | CDP-DG(15:1(11Z)/15:1(9Z)) | Show | YMDB12249 | CDP-DG(15:1(11Z)/16:0) | Show | YMDB12250 | CDP-DG(15:1(11Z)/16:1(11Z)) | Show | YMDB12251 | CDP-DG(15:1(11Z)/16:1(9Z)) | Show | YMDB12252 | CDP-DG(15:1(11Z)/18:0) | Show | YMDB12253 | CDP-DG(15:1(11Z)/18:1(11Z)) | Show | YMDB12254 | CDP-DG(15:1(11Z)/18:1(9Z)) | Show | YMDB12255 | CDP-DG(15:1(11Z)/20:0) | Show | YMDB12256 | CDP-DG(15:1(11Z)/20:1(11Z)) | Show | YMDB12257 | CDP-DG(15:1(11Z)/20:1(13Z)) | Show | YMDB12280 | CDP-DG(15:1(9Z)/15:1(11Z)) | Show | YMDB12281 | CDP-DG(15:1(9Z)/15:1(9Z)) | Show | YMDB12282 | CDP-DG(15:1(9Z)/16:0) | Show | YMDB12283 | CDP-DG(15:1(9Z)/16:1(11Z)) | Show | YMDB12284 | CDP-DG(15:1(9Z)/16:1(9Z)) | Show | YMDB12285 | CDP-DG(15:1(9Z)/18:0) | Show | YMDB12286 | CDP-DG(15:1(9Z)/18:1(11Z)) | Show | YMDB12287 | CDP-DG(15:1(9Z)/18:1(9Z)) | Show | YMDB12288 | CDP-DG(15:1(9Z)/20:0) | Show | YMDB12289 | CDP-DG(15:1(9Z)/20:1(11Z)) | Show | YMDB12290 | CDP-DG(15:1(9Z)/20:1(13Z)) | Show | YMDB12313 | CDP-DG(16:0/16:0) | Show | YMDB12314 | CDP-DG(16:0/16:1(11Z)) | Show | YMDB12315 | CDP-DG(16:0/16:1(9Z)) | Show | YMDB12316 | CDP-DG(16:0/18:0) | Show | YMDB12317 | CDP-DG(16:0/18:1(11Z)) | Show | YMDB12318 | CDP-DG(16:0/18:1(9Z)) | Show | YMDB12319 | CDP-DG(16:0/20:0) | Show | YMDB12320 | CDP-DG(16:0/20:1(11Z)) | Show | YMDB12321 | CDP-DG(16:0/20:1(13Z)) | Show | YMDB12344 | CDP-DG(16:1(11Z)/16:1(11Z)) | Show | YMDB12345 | CDP-DG(16:1(11Z)/16:1(9Z)) | Show | YMDB12346 | CDP-DG(16:1(11Z)/18:0) | Show | YMDB12347 | CDP-DG(16:1(11Z)/18:1(11Z)) | Show | YMDB12348 | CDP-DG(16:1(11Z)/18:1(9Z)) | Show | YMDB12349 | CDP-DG(16:1(11Z)/20:0) | Show | YMDB12350 | CDP-DG(16:1(11Z)/20:1(11Z)) | Show | YMDB12351 | CDP-DG(16:1(11Z)/20:1(13Z)) | Show | YMDB12374 | CDP-DG(16:1(9Z)/16:1(11Z)) | Show | YMDB12375 | CDP-DG(16:1(9Z)/16:1(9Z)) | Show | YMDB12460 | CDP-DG(18:1(9Z)/18:1(9Z)) | Show | YMDB14166 | PGP(10:0/20:0) | Show | YMDB14167 | PGP(10:0/20:1(11Z)) | Show | YMDB14168 | PGP(10:0/20:1(13Z)) | Show | YMDB14169 | PGP(10:0/22:0) | Show | YMDB14170 | PGP(10:0/22:1(11Z)) | Show | YMDB14171 | PGP(10:0/22:1(9Z)) | Show | YMDB14172 | PGP(10:0/23:1(11Z)) | Show | YMDB14173 | PGP(10:0/23:1(9Z)) | Show | YMDB14174 | PGP(10:0/24:0) | Show | YMDB14175 | PGP(10:0/24:1(11Z)) | Show | YMDB14176 | PGP(10:0/24:1(9Z)) | Show | YMDB14177 | PGP(10:0/25:0) | Show | YMDB14178 | PGP(10:0/25:1(11Z)) | Show | YMDB14179 | PGP(10:0/25:1(9Z)) | Show | YMDB14180 | PGP(10:0/26:0) | Show | YMDB14181 | PGP(10:0/26:1(11Z)) | Show | YMDB14182 | PGP(10:0/26:1(9Z)) | Show | YMDB14184 | PGP(12:0/18:0) | Show | YMDB14185 | PGP(12:0/18:1(11Z)) | Show | YMDB14186 | PGP(12:0/18:1(9Z)) | Show | YMDB14187 | PGP(12:0/20:0) | Show | YMDB14188 | PGP(12:0/20:1(11Z)) | Show | YMDB14189 | PGP(12:0/20:1(13Z)) | Show | YMDB14190 | PGP(12:0/22:0) | Show | YMDB14191 | PGP(12:0/22:1(11Z)) | Show | YMDB14192 | PGP(12:0/22:1(9Z)) | Show | YMDB14193 | PGP(12:0/23:1(11Z)) | Show | YMDB14194 | PGP(12:0/23:1(9Z)) | Show | YMDB14195 | PGP(12:0/24:0) | Show | YMDB14196 | PGP(12:0/24:1(11Z)) | Show | YMDB14197 | PGP(12:0/24:1(9Z)) | Show | YMDB14205 | PGP(14:0/15:0) | Show | YMDB14206 | PGP(14:0/16:0) | Show | YMDB14207 | PGP(14:0/16:1(11Z)) | Show | YMDB14208 | PGP(14:0/16:1(9Z)) | Show | YMDB14209 | PGP(14:0/18:0) | Show | YMDB14210 | PGP(14:0/18:1(11Z)) | Show | YMDB14211 | PGP(14:0/18:1(9Z)) | Show | YMDB14212 | PGP(14:0/20:0) | Show | YMDB14213 | PGP(14:0/20:1(11Z)) | Show | YMDB14214 | PGP(14:0/20:1(13Z)) | Show | YMDB14215 | PGP(14:0/22:0) | Show | YMDB14216 | PGP(14:0/22:1(11Z)) | Show | YMDB14217 | PGP(14:0/22:1(9Z)) | Show | YMDB14228 | PGP(14:1(11Z)/16:0) | Show | YMDB14229 | PGP(14:1(11Z)/16:1(11Z)) | Show | YMDB14230 | PGP(14:1(11Z)/16:1(9Z)) | Show | YMDB14231 | PGP(14:1(11Z)/18:0) | Show | YMDB14232 | PGP(14:1(11Z)/18:1(11Z)) | Show | YMDB14233 | PGP(14:1(11Z)/18:1(9Z)) | Show | YMDB14234 | PGP(14:1(11Z)/20:0) | Show | YMDB14235 | PGP(14:1(11Z)/20:1(11Z)) | Show | YMDB14236 | PGP(14:1(11Z)/20:1(13Z)) | Show | YMDB14237 | PGP(14:1(11Z)/22:0) | Show | YMDB14238 | PGP(14:1(11Z)/22:1(11Z)) | Show | YMDB14239 | PGP(14:1(11Z)/22:1(9Z)) | Show | YMDB14250 | PGP(14:1(9Z)/16:0) | Show | YMDB14251 | PGP(14:1(9Z)/16:1(11Z)) | Show | YMDB14252 | PGP(14:1(9Z)/16:1(9Z)) | Show | YMDB14253 | PGP(14:1(9Z)/18:0) | Show | YMDB14254 | PGP(14:1(9Z)/18:1(11Z)) | Show | YMDB14255 | PGP(14:1(9Z)/18:1(9Z)) | Show | YMDB14256 | PGP(14:1(9Z)/20:0) | Show | YMDB14257 | PGP(14:1(9Z)/20:1(11Z)) | Show | YMDB14258 | PGP(14:1(9Z)/20:1(13Z)) | Show | YMDB14259 | PGP(14:1(9Z)/22:0) | Show | YMDB14260 | PGP(14:1(9Z)/22:1(11Z)) | Show | YMDB14261 | PGP(14:1(9Z)/22:1(9Z)) | Show | YMDB14272 | PGP(15:0/15:0) | Show | YMDB14273 | PGP(15:0/15:1(11Z)) | Show | YMDB14274 | PGP(15:0/15:1(9Z)) | Show | YMDB14275 | PGP(15:0/16:0) | Show | YMDB14276 | PGP(15:0/16:1(11Z)) | Show | YMDB14277 | PGP(15:0/16:1(9Z)) | Show | YMDB14278 | PGP(15:0/18:0) | Show | YMDB14279 | PGP(15:0/18:1(11Z)) | Show | YMDB14280 | PGP(15:0/18:1(9Z)) | Show | YMDB14281 | PGP(15:0/20:0) | Show | YMDB14282 | PGP(15:0/20:1(11Z)) | Show | YMDB14283 | PGP(15:0/20:1(13Z)) | Show | YMDB14306 | PGP(15:1(11Z)/15:1(11Z)) | Show | YMDB14307 | PGP(15:1(11Z)/15:1(9Z)) | Show | YMDB14308 | PGP(15:1(11Z)/16:0) | Show | YMDB14309 | PGP(15:1(11Z)/16:1(11Z)) | Show | YMDB14310 | PGP(15:1(11Z)/16:1(9Z)) | Show | YMDB14311 | PGP(15:1(11Z)/18:0) | Show | YMDB14312 | PGP(15:1(11Z)/18:1(11Z)) | Show | YMDB14313 | PGP(15:1(11Z)/18:1(9Z)) | Show | YMDB14314 | PGP(15:1(11Z)/20:0) | Show | YMDB14315 | PGP(15:1(11Z)/20:1(11Z)) | Show | YMDB14316 | PGP(15:1(11Z)/20:1(13Z)) | Show | YMDB14339 | PGP(15:1(9Z)/15:1(11Z)) | Show | YMDB14340 | PGP(15:1(9Z)/15:1(9Z)) | Show | YMDB14341 | PGP(15:1(9Z)/16:0) | Show | YMDB14342 | PGP(15:1(9Z)/16:1(11Z)) | Show | YMDB14343 | PGP(15:1(9Z)/16:1(9Z)) | Show | YMDB14344 | PGP(15:1(9Z)/18:0) | Show | YMDB14345 | PGP(15:1(9Z)/18:1(11Z)) | Show | YMDB14346 | PGP(15:1(9Z)/18:1(9Z)) | Show | YMDB14347 | PGP(15:1(9Z)/20:0) | Show | YMDB14348 | PGP(15:1(9Z)/20:1(11Z)) | Show | YMDB14349 | PGP(15:1(9Z)/20:1(13Z)) | Show | YMDB14372 | PGP(16:0/16:0) | Show | YMDB14373 | PGP(16:0/16:1(11Z)) | Show | YMDB14374 | PGP(16:0/16:1(9Z)) | Show | YMDB14375 | PGP(16:0/18:0) | Show | YMDB14376 | PGP(16:0/18:1(11Z)) | Show | YMDB14377 | PGP(16:0/18:1(9Z)) | Show | YMDB14378 | PGP(16:0/20:0) | Show | YMDB14379 | PGP(16:0/20:1(11Z)) | Show | YMDB14380 | PGP(16:0/20:1(13Z)) | Show | YMDB14403 | PGP(16:1(11Z)/16:1(11Z)) | Show | YMDB14404 | PGP(16:1(11Z)/16:1(9Z)) | Show | YMDB14405 | PGP(16:1(11Z)/18:0) | Show | YMDB14406 | PGP(16:1(11Z)/18:1(11Z)) | Show | YMDB14407 | PGP(16:1(11Z)/18:1(9Z)) | Show | YMDB14408 | PGP(16:1(11Z)/20:0) | Show | YMDB14409 | PGP(16:1(11Z)/20:1(11Z)) | Show | YMDB14410 | PGP(16:1(11Z)/20:1(13Z)) | Show | YMDB14433 | PGP(16:1(9Z)/16:1(11Z)) | Show | YMDB14434 | PGP(16:1(9Z)/16:1(9Z)) | Show | YMDB14519 | PGP(18:1(9Z)/18:1(9Z)) | Show | YMDB16287 | PGP(12:0/12:0) | Show | YMDB16288 | PGP(14:0/14:0) | Show | YMDB16290 | PGP(10:0/10:0) | Show |
|
---|
GO Classification | Component |
---|
Not Available | Function |
---|
transferase activity, transferring phosphorus-containing groups | phosphotransferase activity, for other substituted phosphate groups | catalytic activity | transferase activity | Process |
---|
organophosphate metabolic process | phospholipid metabolic process | phospholipid biosynthetic process | metabolic process |
|
---|
Gene Properties |
---|
Chromosome Location | chromosome 3 |
---|
Locus | YCL004W |
---|
Gene Sequence | >1566 bp
ATGACGACTCGTTTGCTCCAACTCACTCGTCCTCATTACAGATTATTATCCCTACCTCTC
CAGAAACCCTTCAATATAAAAAGGCAGATGTCCGCTGCGAACCCTTCTCCATTTGGCAAT
TATTTGAACACGATCACTAAGTCCCTACAACAGAATTTACAAACATGCTTTCATTTCCAA
GCAAAAGAAATCGATATAATCGAATCTCCATCTCAGTTTTACGATCTCTTGAAGACAAAA
ATACTTAATTCACAAAATAGAATATTCATTGCGTCTCTGTATTTAGGCAAAAGCGAGACT
GAGTTGGTGGACTGCATATCCCAGGCATTGACCAAGAACCCCAAGTTGAAAGTTTCTTTT
CTACTTGATGGCCTTCGAGGAACAAGAGAATTGCCTTCCGCCTGTTCCGCCACTTTATTA
TCGTCTTTAGTAGCCAAATATGGGTCAGAGAGAGTGGATTGCCGATTGTACAAGACGCCT
GCTTATCATGGTTGGAAAAAAGTCTTGGTTCCCAAGAGATTTAATGAAGGTTTAGGCTTA
CAACATATGAAAATATATGGGTTTGATAACGAGGTCATTCTTTCGGGAGCCAACCTTTCG
AACGACTATTTCACCAACAGACAAGATAGATACTATCTCTTTAAATCTCGAAACTTCTCC
AACTATTATTTTAAATTACATCAACTCATAAGTTCCTTCAGTTATCAGATTATAAAGCCA
ATGGTGGATGGTAGCATCAACATCATTTGGCCAGATTCGAATCCTACTGTTGAACCGACG
AAAAATAAAAGGCTGTTTTTAAGGGAAGCATCTCAATTACTAGATGGCTTTTTAAAGAGT
TCTAAACAAAGCCTCCCGATTACTGCCGTGGGTCAATTCTCCACATTAGTTTACCCAATT
TCTCAATTCACTCCACTTTTTCCCAAATATAATGACAAATCGACCGAAAAAAGAACAATA
TTGTCATTGCTTTCCACTATAACAAGCAATGCCATTTCTTGGACGTTCACTGCAGGATAC
TTCAATATTTTGCCAGACATCAAAGCAAAACTGCTGGCAACGCCGGTTGCTGAGGCAAAT
GTAATAACAGCTTCCCCCTTTGCAAACGGCTTTTACCAATCAAAGGGCGTCTCATCAAAT
TTACCTGGTGCTTACTTGTACCTGTCAAAAAAATTTCTACAAGATGTATGTAGGTACAGA
CAAGATCATGCTATTACATTAAGAGAATGGCAAAGAGGCGTAGTAAATAAGCCGAATGGT
TGGTCATATCACGCAAAAGGTATTTGGCTTTCCGCTCGTGATAAAAATGATGCTAACAAT
TGGAAACCCTTTATCACGGTTATAGGATCTTCAAACTATACGAGAAGGGCGTATTCATTA
GATTTGGAATCGAATGCTCTCATTATTACAAGAGATGAAGAGCTAAGAAAAAAAATGAAA
GCAGAGTTAGATAATTTATTACAATATACAAAACCTGTAACTCTAGAAGACTTTCAATCA
GACCCAGAAAGACATGTTGGCACTGGTGTAAAGATAGCTACCTCCATTTTGGGTAAAAAA
CTTTAG |
---|
Protein Properties |
---|
Pfam Domain Function | |
---|
Protein Residues | 521 |
---|
Protein Molecular Weight | 59369.69922 |
---|
Protein Theoretical pI | 10.15 |
---|
Signalling Regions | |
---|
Transmembrane Regions | |
---|
Protein Sequence | >CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
MTTRLLQLTRPHYRLLSLPLQKPFNIKRQMSAANPSPFGNYLNTITKSLQQNLQTCFHFQ
AKEIDIIESPSQFYDLLKTKILNSQNRIFIASLYLGKSETELVDCISQALTKNPKLKVSF
LLDGLRGTRELPSACSATLLSSLVAKYGSERVDCRLYKTPAYHGWKKVLVPKRFNEGLGL
QHMKIYGFDNEVILSGANLSNDYFTNRQDRYYLFKSRNFSNYYFKLHQLISSFSYQIIKP
MVDGSINIIWPDSNPTVEPTKNKRLFLREASQLLDGFLKSSKQSLPITAVGQFSTLVYPI
SQFTPLFPKYNDKSTEKRTILSLLSTITSNAISWTFTAGYFNILPDIKAKLLATPVAEAN
VITASPFANGFYQSKGVSSNLPGAYLYLSKKFLQDVCRYRQDHAITLREWQRGVVNKPNG
WSYHAKGIWLSARDKNDANNWKPFITVIGSSNYTRRAYSLDLESNALIITRDEELRKKMK
AELDNLLQYTKPVTLEDFQSDPERHVGTGVKIATSILGKKL |
---|
References |
---|
External Links | |
---|
General Reference | - Janitor, M., Jarosch, E., Schweyen, R. J., Subik, J. (1995). "Molecular characterization of the PEL1 gene encoding a putative phosphatidylserine synthase." Yeast 11:1223-1231.8553693
- Chang, S. C., Heacock, P. N., Clancey, C. J., Dowhan, W. (1998). "The PEL1 gene (renamed PGS1) encodes the phosphatidylglycero-phosphate synthase of Saccharomyces cerevisiae." J Biol Chem 273:9829-9836.9545322
- Janitor, M., Subik, J. (1993). "Molecular cloning of the PEL1 gene of Saccharomyces cerevisiae that is essential for the viability of petite mutants." Curr Genet 24:307-312.8252640
- Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
- Dzugasova, V., Obernauerova, M., Horvathova, K., Vachova, M., Zakova, M., Subik, J. (1998). "Phosphatidylglycerolphosphate synthase encoded by the PEL1/PGS1 gene in Saccharomyces cerevisiae is localized in mitochondria and its expression is regulated by phospholipid precursors." Curr Genet 34:297-302.9799363
- Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
|
---|