Identification |
---|
Name | Mitochondrial distribution and morphology protein 35 |
---|
Synonyms | Not Available |
---|
Gene Name | MDM35 |
---|
Enzyme Class | Not Available |
---|
Biological Properties |
---|
General Function | protein targeting to mitochondrion |
---|
Specific Function | Involved in mitochondrial distribution and morphology. Mediates the import of UPS1, UPS2 and UPS3, 3 atypical mitochondrial intermembrane space (IMS) proteins lacking the two major IMS-targeting signals, into the intermembrane space. The UPS1:MDM35 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space (PubMed:26071602, PubMed:26071601, PubMed:26235513). Phosphatidic acid import is required for cardiolipin (CL) synthesis in the mitochondrial inner membrane (PubMed:26071602). |
---|
Cellular Location | Not Available |
---|
SMPDB Pathways | Cardiolipin Biosynthesis CL(15:1(9Z)/15:1(11Z)/15:1(11Z)/23:1(9Z)) | PW012105 | | Cardiolipin Biosynthesis CL(15:1(9Z)/15:1(11Z)/15:1(11Z)/25:0) | PW012106 | | Cardiolipin Biosynthesis CL(15:1(9Z)/15:1(11Z)/15:1(11Z)/25:1(11Z)) | PW012107 | | Cardiolipin Biosynthesis CL(15:1(9Z)/15:1(11Z)/15:1(11Z)/25:1(9Z)) | PW012108 | | Cardiolipin Biosynthesis CL(15:1(9Z)/15:1(11Z)/15:1(11Z)/27:0) | PW012109 | |
|
---|
KEGG Pathways | Not Available |
---|
SMPDB Reactions | Not Available |
---|
KEGG Reactions | Not Available |
---|
Metabolites | |
---|
GO Classification | Function |
---|
mitochondrial respiratory chain complex assembly | mitochondrion organization | protein targeting to mitochondrion | mitochondrial intermembrane space | nucleus | lipid transport |
|
---|
Gene Properties |
---|
Chromosome Location | Not Available |
---|
Locus | |
---|
Gene Sequence | >261 bp
ATGGGGAATATAATGTCAGCTAGTTTTGCGCCTGAATGCACTGACCTGAAGACGAAATAC
GATAGTTGTTTTAATGAATGGTATAGCGAAAAATTCCTGAAGGGAAAATCCGTTGAGAAC
GAGTGCTCAAAACAATGGTACGCTTATACTACATGTGTCAACGCAGCTCTCGTCAAACAA
GGTATTAAGCCTGCTCTAGACGAAGCTAGGGAGGAGGCGCCGTTTGAAAATGGCGGCAAA
CTAAAAGAAGTTGACAAATGA |
---|
Protein Properties |
---|
Pfam Domain Function | Not Available |
---|
Protein Residues | 86 |
---|
Protein Molecular Weight | 9711.885 |
---|
Protein Theoretical pI | Not Available |
---|
PDB File | show |
---|
Signalling Regions | Not Available |
---|
Transmembrane Regions | Not Available |
---|
Protein Sequence | >Mitochondrial distribution and morphology protein 35
MGNIMSASFAPECTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVNAALVKQ
GIKPALDEAREEAPFENGGKLKEVDK |
---|
References |
---|
External Links | |
---|
General Reference | Not Available |
---|