Mitochondrial distribution and morphology protein 35 (O60200)
Identification | ||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Name | Mitochondrial distribution and morphology protein 35 | |||||||||||||||
Synonyms | Not Available | |||||||||||||||
Gene Name | MDM35 | |||||||||||||||
Enzyme Class | Not Available | |||||||||||||||
Biological Properties | ||||||||||||||||
General Function | protein targeting to mitochondrion | |||||||||||||||
Specific Function | Involved in mitochondrial distribution and morphology. Mediates the import of UPS1, UPS2 and UPS3, 3 atypical mitochondrial intermembrane space (IMS) proteins lacking the two major IMS-targeting signals, into the intermembrane space. The UPS1:MDM35 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space (PubMed:26071602, PubMed:26071601, PubMed:26235513). Phosphatidic acid import is required for cardiolipin (CL) synthesis in the mitochondrial inner membrane (PubMed:26071602). | |||||||||||||||
Cellular Location | Not Available | |||||||||||||||
SMPDB Pathways |
| |||||||||||||||
KEGG Pathways | Not Available | |||||||||||||||
SMPDB Reactions | Not Available | |||||||||||||||
KEGG Reactions | Not Available | |||||||||||||||
Metabolites |
| |||||||||||||||
GO Classification |
| |||||||||||||||
Gene Properties | ||||||||||||||||
Chromosome Location | Not Available | |||||||||||||||
Locus | ||||||||||||||||
Gene Sequence | >261 bp ATGGGGAATATAATGTCAGCTAGTTTTGCGCCTGAATGCACTGACCTGAAGACGAAATAC GATAGTTGTTTTAATGAATGGTATAGCGAAAAATTCCTGAAGGGAAAATCCGTTGAGAAC GAGTGCTCAAAACAATGGTACGCTTATACTACATGTGTCAACGCAGCTCTCGTCAAACAA GGTATTAAGCCTGCTCTAGACGAAGCTAGGGAGGAGGCGCCGTTTGAAAATGGCGGCAAA CTAAAAGAAGTTGACAAATGA | |||||||||||||||
Protein Properties | ||||||||||||||||
Pfam Domain Function | Not Available | |||||||||||||||
Protein Residues | 86 | |||||||||||||||
Protein Molecular Weight | 9711.885 | |||||||||||||||
Protein Theoretical pI | Not Available | |||||||||||||||
PDB File | show | |||||||||||||||
Signalling Regions | Not Available | |||||||||||||||
Transmembrane Regions | Not Available | |||||||||||||||
Protein Sequence | >Mitochondrial distribution and morphology protein 35 MGNIMSASFAPECTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVNAALVKQ GIKPALDEAREEAPFENGGKLKEVDK | |||||||||||||||
References | ||||||||||||||||
External Links |
| |||||||||||||||
General Reference | Not Available |