Mitochondrial distribution and morphology protein 35 (O60200)
| Identification | ||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Name | Mitochondrial distribution and morphology protein 35 | |||||||||||||||
| Synonyms | Not Available | |||||||||||||||
| Gene Name | MDM35 | |||||||||||||||
| Enzyme Class | Not Available | |||||||||||||||
| Biological Properties | ||||||||||||||||
| General Function | protein targeting to mitochondrion | |||||||||||||||
| Specific Function | Involved in mitochondrial distribution and morphology. Mediates the import of UPS1, UPS2 and UPS3, 3 atypical mitochondrial intermembrane space (IMS) proteins lacking the two major IMS-targeting signals, into the intermembrane space. The UPS1:MDM35 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space (PubMed:26071602, PubMed:26071601, PubMed:26235513). Phosphatidic acid import is required for cardiolipin (CL) synthesis in the mitochondrial inner membrane (PubMed:26071602). | |||||||||||||||
| Cellular Location | Not Available | |||||||||||||||
| SMPDB Pathways |
| |||||||||||||||
| KEGG Pathways | Not Available | |||||||||||||||
| SMPDB Reactions | Not Available | |||||||||||||||
| KEGG Reactions | Not Available | |||||||||||||||
| Metabolites |
| |||||||||||||||
| GO Classification |
| |||||||||||||||
| Gene Properties | ||||||||||||||||
| Chromosome Location | Not Available | |||||||||||||||
| Locus | ||||||||||||||||
| Gene Sequence | >261 bp ATGGGGAATATAATGTCAGCTAGTTTTGCGCCTGAATGCACTGACCTGAAGACGAAATAC GATAGTTGTTTTAATGAATGGTATAGCGAAAAATTCCTGAAGGGAAAATCCGTTGAGAAC GAGTGCTCAAAACAATGGTACGCTTATACTACATGTGTCAACGCAGCTCTCGTCAAACAA GGTATTAAGCCTGCTCTAGACGAAGCTAGGGAGGAGGCGCCGTTTGAAAATGGCGGCAAA CTAAAAGAAGTTGACAAATGA | |||||||||||||||
| Protein Properties | ||||||||||||||||
| Pfam Domain Function | Not Available | |||||||||||||||
| Protein Residues | 86 | |||||||||||||||
| Protein Molecular Weight | 9711.885 | |||||||||||||||
| Protein Theoretical pI | Not Available | |||||||||||||||
| PDB File | show | |||||||||||||||
| Signalling Regions | Not Available | |||||||||||||||
| Transmembrane Regions | Not Available | |||||||||||||||
| Protein Sequence | >Mitochondrial distribution and morphology protein 35 MGNIMSASFAPECTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVNAALVKQ GIKPALDEAREEAPFENGGKLKEVDK | |||||||||||||||
| References | ||||||||||||||||
| External Links |
| |||||||||||||||
| General Reference | Not Available | |||||||||||||||