Deoxyuridine 5'-triphosphate nucleotidohydrolase (P33317)

Identification
NameDeoxyuridine 5'-triphosphate nucleotidohydrolase
Synonyms
  • dUTPase
  • dUTP pyrophosphatase
Gene NameDUT1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity
Specific FunctionThis enzyme is involved in nucleotide metabolism:it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA
Cellular LocationCytoplasmic
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG Reactions
Deoxyuridine triphosphate + water → Pyrophosphate + dUMP + hydron
Metabolites
YMDB IDNameView
YMDB00201Deoxyuridine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00221dUMPShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
pyrophosphatase activity
nucleoside-triphosphate diphosphatase activity
dUTP diphosphatase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
Process
pyrimidine nucleoside triphosphate metabolic process
metabolic process
pyrimidine deoxyribonucleoside triphosphate metabolic process
nitrogen compound metabolic process
dUTP metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
pyrimidine nucleotide metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR252W
Gene Sequence>444 bp ATGACTGCTACTAGCGACAAAGTACTAAAGATTCAATTGCGCTCAGCAAGCGCTACTGTA CCTACCAAAGGTTCTGCCACTGCCGCGGGATACGACATTTATGCATCTCAGGATATTACC ATTCCGGCTATGGGTCAAGGTATGGTTTCCACCGACATATCGTTCACCGTACCTGTTGGT ACCTACGGTCGTATTGCGCCAAGGTCAGGCCTGGCAGTGAAAAACGGTATCCAAACCGGT GCTGGTGTTGTCGACAGAGATTACACCGGTGAAGTTAAAGTAGTTTTATTCAATCATTCA CAGAGGGATTTCGCGATCAAAAAAGGTGATCGCGTAGCCCAATTGATTCTGGAAAAAATT GTCGATGATGCCCAGATCGTTGTTGTAGACTCTCTGGAAGAAAGTGCAAGAGGGGCCGGT GGCTTTGGTAGCACTGGTAACTAA
Protein Properties
Pfam Domain Function
Protein Residues147
Protein Molecular Weight15307.2002
Protein Theoretical pI7.52
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Deoxyuridine 5'-triphosphate nucleotidohydrolase MTATSDKVLKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVG TYGRIAPRSGLAVKNGIQTGAGVVDRDYTGEVKVVLFNHSQRDFAIKKGDRVAQLILEKI VDDAQIVVVDSLEESARGAGGFGSTGN
References
External Links
ResourceLink
Saccharomyces Genome Database DUT1
Uniprot IDP33317
Uniprot NameDUT_YEAST
GenBank Gene IDAY693064
Genebank Protein ID51013579
General Reference
  • Gadsden, M. H., McIntosh, E. M., Game, J. C., Wilson, P. J., Haynes, R. H. (1993). "dUTP pyrophosphatase is an essential enzyme in Saccharomyces cerevisiae." EMBO J 12:4425-4431.8223452
  • Doignon, F., Biteau, N., Aigle, M., Crouzet, M. (1993). "The complete sequence of a 6794 bp segment located on the right arm of chromosome II of Saccharomyces cerevisiae. Finding of a putative dUTPase in a yeast." Yeast 9:1131-1137.8256522
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956