Identification
NameATP synthase subunit epsilon, mitochondrial
Synonyms
  • ATPase subunit epsilon
Gene NameATP15
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in hydrogen ion transporting ATP synthase acti
Specific FunctionMitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits
Cellular LocationMitochondrion. Mitochondrion inner membrane
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Component
membrane part
mitochondrial membrane part
mitochondrial proton-transporting ATP synthase complex, catalytic core F(1)
cell part
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
proton-transporting ATPase activity, rotational mechanism
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transporting ATP synthase activity, rotational mechanism
hydrogen ion transmembrane transporter activity
Process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
ATP biosynthetic process
ATP synthesis coupled proton transport
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
metabolic process
purine nucleotide metabolic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>189 bp ATGTCTGCCTGGAGGAAAGCTGGTATATCATATGCTGCATATTTGAATGTGGCCGCTCAG GCTATCCGTTCTTCATTGAAAACTGAATTACAAACCGCTAGTGTTCTTAACAGATCGCAA ACAGATGCTTTTTATACCCAATATAAAAATGGCACTGCAGCTTCTGAACCCACTCCAATA ACAAAATAG
Protein Properties
Pfam Domain Function
Protein Residues62
Protein Molecular Weight6742.5
Protein Theoretical pI10.19
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>ATP synthase subunit epsilon, mitochondrial MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI TK
References
External Links
ResourceLink
Saccharomyces Genome Database ATP15
Uniprot IDP21306
Uniprot NameATP5E_YEAST
GenBank Gene IDAY558140
Genebank Protein ID45270170
General Reference
  • Guelin, E., Chevallier, J., Rigoulet, M., Guerin, B., Velours, J. (1993). "ATP synthase of yeast mitochondria. Isolation and disruption of the ATP epsilon gene." J Biol Chem 268:161-167.8416924
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Arselin, G., Gandar, J. C., Guerin, B., Velours, J. (1991). "Isolation and complete amino acid sequence of the mitochondrial ATP synthase epsilon-subunit of the yeast Saccharomyces cerevisiae." J Biol Chem 266:723-727.1985960
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666