Identification
NameCytochrome c oxidase subunit 7A
Synonyms
  • Cytochrome c oxidase polypeptide VIIA
Gene NameCOX9
Enzyme Class
Biological Properties
General FunctionInvolved in cytochrome-c oxidase activity
Specific FunctionThis small integral protein plays a role in holoenzyme assembly or stability
Cellular LocationMitochondrion inner membrane
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00862hydronShow
GO Classification
Component
mitochondrial respiratory chain
cell part
membrane part
mitochondrial membrane part
Function
catalytic activity
oxidoreductase activity
heme-copper terminal oxidase activity
cytochrome-c oxidase activity
Process
metabolic process
cellular metabolic process
oxidation reduction
generation of precursor metabolites and energy
electron transport chain
respiratory electron transport chain
Gene Properties
Chromosome Locationchromosome 4
LocusYDL067C
Gene Sequence>180 bp ATGACTATTGCTCCAATTACTGGTACGATCAAGAGAAGAGTCATCATGGACATCGTCCTC GGGTTCTCCCTCGGGGGTGTCATGGCCTCTTACTGGTGGTGGGGATTCCACATGGATAAG ATTAACAAGAGAGAGAAGTTCTACGCAGAGCTAGCTGAGAGGAAAAAGCAAGAGAACTGA
Protein Properties
Pfam Domain Function
Protein Residues59
Protein Molecular Weight6963.2002
Protein Theoretical pI10.39
Signalling Regions
  • None
Transmembrane Regions
  • 16-34
Protein Sequence>Cytochrome c oxidase subunit 7A MTIAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKREKFYAELAERKKQEN
References
External Links
ResourceLink
Saccharomyces Genome Database COX9
Uniprot IDP07255
Uniprot NameCOX9_YEAST
GenBank Gene IDAY558525
Genebank Protein ID45270940
General Reference
  • Wright, R. M., Dircks, L. K., Poyton, R. O. (1986). "Characterization of COX9, the nuclear gene encoding the yeast mitochondrial protein cytochrome c oxidase subunit VIIa. Subunit VIIa lacks a leader peptide and is an essential component of the holoenzyme." J Biol Chem 261:17183-17191.3023385
  • Duhl, D. M., Powell, T., Poyton, R. O. (1990). "Mitochondrial import of cytochrome c oxidase subunit VIIa in Saccharomyces cerevisiae. Identification of sequences required for mitochondrial localization in vivo." J Biol Chem 265:7273-7277.2158998
  • Forsbach, V., Pillar, T., Gottenof, T., Rodel, G. (1989). "Chromosomal localization and expression of CBS1, a translational activator of cytochrome b in yeast." Mol Gen Genet 218:57-63.2550765
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Power, S. D., Lochrie, M. A., Poyton, R. O. (1986). "The nuclear-coded subunits of yeast cytochrome c oxidase. The amino acid sequences of subunits VII and VIIa, structural similarities between the three smallest polypeptides of the holoenzyme, and implications for biogenesis." J Biol Chem 261:9206-9209.3013877
  • Geier, B. M., Schagger, H., Ortwein, C., Link, T. A., Hagen, W. R., Brandt, U., Von Jagow, G. (1995). "Kinetic properties and ligand binding of the eleven-subunit cytochrome-c oxidase from Saccharomyces cerevisiae isolated with a novel large-scale purification method." Eur J Biochem 227:296-302.7851399
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106