ATP synthase protein 8 (P00856)
Identification | |||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Name | ATP synthase protein 8 | ||||||||||||||||||||||||||||
Synonyms |
| ||||||||||||||||||||||||||||
Gene Name | ATP8 | ||||||||||||||||||||||||||||
Enzyme Class | Not Available | ||||||||||||||||||||||||||||
Biological Properties | |||||||||||||||||||||||||||||
General Function | Involved in hydrogen ion transmembrane transporter acti | ||||||||||||||||||||||||||||
Specific Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane | ||||||||||||||||||||||||||||
Cellular Location | Mitochondrion membrane; Single-pass membrane protein | ||||||||||||||||||||||||||||
SMPDB Pathways | Not Available | ||||||||||||||||||||||||||||
KEGG Pathways | Not Available | ||||||||||||||||||||||||||||
SMPDB Reactions | Not Available | ||||||||||||||||||||||||||||
KEGG Reactions | Not Available | ||||||||||||||||||||||||||||
Metabolites |
| ||||||||||||||||||||||||||||
GO Classification |
| ||||||||||||||||||||||||||||
Gene Properties | |||||||||||||||||||||||||||||
Chromosome Location | Not Available | ||||||||||||||||||||||||||||
Locus | |||||||||||||||||||||||||||||
Gene Sequence | >147 bp ATGCCACAATTAGTTCCATTTTATTTTATGAATCAATTAACATATGGTTTCTTATTAATG ATTCTATTATTAATTTTATTCTCACAATTCTTTTTACCTATGATCTTAAGATTATATGTA TCTAGATTATTTATTTCTAAATTATAA | ||||||||||||||||||||||||||||
Protein Properties | |||||||||||||||||||||||||||||
Pfam Domain Function |
| ||||||||||||||||||||||||||||
Protein Residues | 48 | ||||||||||||||||||||||||||||
Protein Molecular Weight | 5822.2002 | ||||||||||||||||||||||||||||
Protein Theoretical pI | 10.27 | ||||||||||||||||||||||||||||
Signalling Regions |
| ||||||||||||||||||||||||||||
Transmembrane Regions |
| ||||||||||||||||||||||||||||
Protein Sequence | >ATP synthase protein 8 MPQLVPFYFMNQLTYGFLLMITLLILFSQFFLPMILRLYVSRLFISKL | ||||||||||||||||||||||||||||
References | |||||||||||||||||||||||||||||
External Links |
| ||||||||||||||||||||||||||||
General Reference |
|