Identification
NameCytochrome c oxidase polypeptide 5A, mitochondrial
Synonyms
  • Cytochrome c oxidase polypeptide Va
Gene NameCOX5A
Enzyme Class
Biological Properties
General FunctionInvolved in cytochrome-c oxidase activity
Specific Function4 ferrocytochrome c + O(2) + 4 H(+) = 4 ferricytochrome c + 2 H(2)O
Cellular LocationMitochondrion inner membrane
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
oxidoreductase activity
heme-copper terminal oxidase activity
cytochrome-c oxidase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 14
LocusYNL052W
Gene Sequence>462 bp ATGTTACGTAACACTTTTACTAGAGCTGGTGGACTATCACGTATTACATCCGTAAGATTC GCTCAAACACATGCTCTTTCCAACGCTGCTGTAATGGATCTGCAATCCAGATGGGAGAAC ATGCCCTCCACTGAGCAGCAGGATATTGTCAGTAAGTTGAGTGAACGTCAAAAATTACCA TGGGCACAGCTTACTGAGCCTGAAAAGCAAGCTGTGTGGTACATTTCTTACGGAGAATGG GGCCCAAGAAGACCTGTATTGAATAAGGGTGATTCCAGTTTTATTGCCAAAGGTGTTGCT GCAGGCCTACTATTTTCAGTGGGACTTTTTGCTGTCGTCAGGATGGCGGGTGGCCAAGAC GCAAAGACCATGAATAAGGAGTGGCAGCTAAAGAGTGACGAATATTTGAAGTCGAAGAAT GCTAATCCTTGGGGTGGTTATTCTCAGGTCCAATCTAAATGA
Protein Properties
Pfam Domain Function
Protein Residues153
Protein Molecular Weight17140.40039
Protein Theoretical pI10.42
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytochrome c oxidase polypeptide 5A, mitochondrial MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLP WAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQD AKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK
References
External Links
ResourceLink
Saccharomyces Genome Database COX5A
Uniprot IDP00424
Uniprot NameCOX5A_YEAST
GenBank Gene IDAY558131
Genebank Protein ID45270152
General Reference
  • Seraphin, B., Simon, M., Faye, G. (1985). "Primary structure of a gene for subunit V of the cytochrome c oxidase from Saccharomyces cerevisiae." Curr Genet 9:435-439.2836092
  • Koerner, T. J., Hill, J., Tzagoloff, A. (1985). "Cloning and characterization of the yeast nuclear gene for subunit 5 of cytochrome oxidase." J Biol Chem 260:9513-9515.2991248
  • Cumsky, M. G., Trueblood, C. E., Ko, C., Poyton, R. O. (1987). "Structural analysis of two genes encoding divergent forms of yeast cytochrome c oxidase subunit V." Mol Cell Biol 7:3511-3519.2824989
  • Bergez, P., Doignon, F., Crouzet, M. (1995). "The sequence of a 44 420 bp fragment located on the left arm of chromosome XIV from Saccharomyces cerevisiae." Yeast 11:967-974.8533472
  • Bergez, P., Doignon, F., Crouzet, M. (1996). "Corrigendum to: the sequence of a 44 458 bp fragment located on the left arm of chromosome XIV from Saccharomyces cervisiae." Yeast 12:297.8904343
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Cumsky, M. G., Ko, C., Trueblood, C. E., Poyton, R. O. (1985). "Two nonidentical forms of subunit V are functional in yeast cytochrome c oxidase." Proc Natl Acad Sci U S A 82:2235-2239.2986105
  • Power, S. D., Lochrie, M. A., Poyton, R. O. (1984). "The nuclear-coded subunits of yeast cytochrome c oxidase. III. Identification of homologous subunits in yeast, bovine heart, and Neurospora crassa cytochrome c oxidases." J Biol Chem 259:6575-6578.6327686
  • Cerletti, N., Bohni, P. C., Suda, K. (1983). "Import of proteins into mitochondria. Isolated yeast mitochondria and a solubilized matrix protease correctly process cytochrome c oxidase subunit V precursor at the NH2 terminus." J Biol Chem 258:4944-4949.6300105
  • Geier, B. M., Schagger, H., Ortwein, C., Link, T. A., Hagen, W. R., Brandt, U., Von Jagow, G. (1995). "Kinetic properties and ligand binding of the eleven-subunit cytochrome-c oxidase from Saccharomyces cerevisiae isolated with a novel large-scale purification method." Eur J Biochem 227:296-302.7851399
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106