Identification |
---|
Name | Cytochrome c oxidase subunit 2 |
---|
Synonyms | - Cytochrome c oxidase polypeptide II
|
---|
Gene Name | COX2 |
---|
Enzyme Class | |
---|
Biological Properties |
---|
General Function | Involved in copper ion binding |
---|
Specific Function | Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1 |
---|
Cellular Location | Mitochondrion inner membrane; Multi-pass membrane protein |
---|
SMPDB Pathways | |
---|
KEGG Pathways | |
---|
SMPDB Reactions | Not Available |
---|
KEGG Reactions | Not Available |
---|
Metabolites | YMDB ID | Name | View |
---|
YMDB00862 | hydron | Show |
|
---|
GO Classification | Component |
---|
cell part | membrane | membrane part | intrinsic to membrane | integral to membrane | Function |
---|
ion binding | cation binding | metal ion binding | transition metal ion binding | iron ion binding | oxidoreductase activity | heme binding | electron carrier activity | catalytic activity | heme-copper terminal oxidase activity | cytochrome-c oxidase activity | copper ion binding | binding | Process |
---|
generation of precursor metabolites and energy | metabolic process | electron transport chain | respiratory electron transport chain | cellular metabolic process |
|
---|
Gene Properties |
---|
Chromosome Location | chromosome 17 |
---|
Locus | Q0250 |
---|
Gene Sequence | >756 bp
ATGTTAGATTTATTAAGATTACAATTAACAACATTCATTATGAATGATGTACCAACACCT
TATGCATGTTATTTTCAGGATTCAGCAACACCAAATCAAGAAGGTATTTTAGAATTACAT
GATAATATTATGTTTTATTTATTAGTTATTTTAGGTTTAGTATCTTGAATGTTATATACA
ATTGTTATAACATATTCAAAAAATCCTATTGCATATAAATATATTAAACATGGACAAACT
ATTGAAGTTATTTGAACAATTTTTCCAGCTGTAATTTTATTAATTATTGCTTTTCCTTCA
TTTATTTTATTATATTTATGTGATGAAGTTATTTCACCAGCTATAACTATTAAAGCTATT
GGATATCAATGATATTGAAAATATGAATATTCAGATTTTATTAATGATAGTGGTGAAACT
GTTGAATTTGAATCATATGTTATTCCTGATGAATTATTAGAAGAAGGTCAATTAAGATTA
TTAGATACTGATACTTCTATAGTTGTACCTGTAGATACACATATTAGATTCGTTGTAACA
GCTGCTGATGTTATTCATGATTTTGCTATTCCAAGTTTAGGTATTAAAGTTGATGCTACT
CCTGGTAGATTAAATCAAGTTTCTGCTTTAATTCAAAGAGAAGGTGTCTTCTATGGAGCA
TGTTCTGAGTTGTGTGGGACAGGTCATGCAAATATGCCAATTAAGATCGAAGCAGTATCA
TTACCTAAATTTTTGGAATGATTAAATGAACAATAA |
---|
Protein Properties |
---|
Pfam Domain Function | |
---|
Protein Residues | 251 |
---|
Protein Molecular Weight | 28566.90039 |
---|
Protein Theoretical pI | 4.2 |
---|
Signalling Regions | |
---|
Transmembrane Regions | |
---|
Protein Sequence | >Cytochrome c oxidase subunit 2
MLDLLRLQLTTFIMNDVPTPYACYFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYT
IVMTYSKNPIAYKYIKHGQTIEVIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAI
GYQWYWKYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVT
AADVIHDFAIPSLGIKVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVS
LPKFLEWLNEQ |
---|
References |
---|
External Links | |
---|
General Reference | - Coruzzi, G., Tzagoloff, A. (1979). "Assembly of the mitochondrial membrane system. DNA sequence of subunit 2 of yeast cytochrome oxidase." J Biol Chem 254:9324-9330.225327
- Fox, T. D. (1979). "Five TGA "stop" codons occur within the translated sequence of the yeast mitochondrial gene for cytochrome c oxidase subunit II." Proc Natl Acad Sci U S A 76:6534-6538.230513
- Foury, F., Roganti, T., Lecrenier, N., Purnelle, B. (1998). "The complete sequence of the mitochondrial genome of Saccharomyces cerevisiae." FEBS Lett 440:325-331.9872396
- Cameron, V. L., Fox, T. D., Poyton, R. O. (1989). "Isolation and characterization of a yeast strain carrying a mutation in the mitochondrial promoter for COX2." J Biol Chem 264:13391-13394.2547760
- Macino, G., Coruzzi, G., Nobrega, F. G., Li, M., Tzagoloff, A. (1979). "Use of the UGA terminator as a tryptophan codon in yeast mitochondria." Proc Natl Acad Sci U S A 76:3784-3785.226981
- Geier, B. M., Schagger, H., Ortwein, C., Link, T. A., Hagen, W. R., Brandt, U., Von Jagow, G. (1995). "Kinetic properties and ligand binding of the eleven-subunit cytochrome-c oxidase from Saccharomyces cerevisiae isolated with a novel large-scale purification method." Eur J Biochem 227:296-302.7851399
|
---|